The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
 
The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

BUSINESS TUNING ATELIER

Exclusive distributor of the HASHEIGHT's products.

 

WHO WE ARE

BOOST is a global shared service company rendering services to the HASHEIGHT Game's residents. We maintain  the real and virtual infrastructure of the Game's shared economy and administer Business Playhouse.

Plug & Play Business

SG&A Shared Services

Digital Marketing

Global Procurement

Business Artifacts

Business Playhouse

HASHEIGHT's products are sensitive to the quality of the primary data. BOOST maximizes the customer value of the expected outcome by ensuring a reliable, transparent accounting. Advanced HASHEIGHT products are available exclusively for the BOOST's Clients.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
WELCOME TO THE CLUB!

BOOST YOUR MARGIN!

That's a graphic image from the BOOST BUSINESS TUNING ATELIER website. Read more on www.boostcmg.com

BOOST provides trustful SG&A, accounting, sales, and procurement solutions to increase the value of your business, save your time and money.

Decrease of fixed costs

Optimization of costs structure

Consistently high quality of services

Low variable costs

Transparent expenses

Fraud-free environment

0-error rate

Real-time transactions

To maximize your savings and operational excellence, in addition to our shared services and global procurement, improve your internal controls and outsource internal audit function by using U Ultra Antifraud services.

ULTRA INSTAGRAM  BACKGROUNDS PUBLICATION. The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

THE GAME

BOOST is a global vendor of shared services and global procurement for Game residents. For business residents of the Game, we maintain Business Playhouse to organize business games, business competitions, and off-track betting.

business-tuning

BOOST covers a part of the HASHEIGHT B2B products related to the quality of primary data to deliver you the best quality of service. For this purpose, BOOST maintains and develops SG&A and global procurement core competencies. We provide ready-to-use solutions optimizing your costs and improving cash flows. For the HASHEIGHT products, we provide automated consulting tailored for your business and render top-notch shared services. That can increase the value of your equity and improve operations. We transform the best world-class expertise into a commodity to make the knowledge available for everyone. BOOST charges relevant price comfortable for every company for all our products.

To create excellent accounting, you have to be a great accountant. That is our business, not yours.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

GAIN TOOL

BOOST YOUR BUSINESS

 
Image by Matt Flores

business artifacts

12.png

high-end business products

Business artifacts are devices that greatly improve your business. They allow you to significantly increase your company's profitability, achieve sustainable, high-quality organic sales growth, reduce costs and improve the capital structure. With our business artifacts, your business will become much more profitable and sustainable. For small businesses, we offer the #8 plug-and-play business tracker. For large companies, you can purchase the Crystal Ball. The public sector can enjoy Pink Sapphire. Artifacts allow you to connect to our Shared Service Centers and get the most out of your business. You will be able to accelerate development and qualitatively improve the performance of your company. Hence, a part of the artifacts functionality will be available in freemium mobile applications that you can install and use free of charge even without using our services. BOOST is an exclusive distributor of business artifacts and maintains the back-end business operations of the artifacts functionality - "business tunes."

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

SMALL & MEDIUM ENTERPRISES

BOOST provides you the unique opportunity to get access to the top-notch expertise at the relevant price, be switched on the sharing economy, and get all the scale-related benefits previously available only for large players. We exclusively serve #8 users.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

LARGE-SCALE BUSINESS

BOOST provides you with a fraud-free environment, timely and reliable data, transparent costs for all SG&A and commercial operations, cash flows. We exclusively serve Crystal Ball users.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
 

PLUG & PLAY BUSINESS

Step #1. Set up.

READY-TO-WORK

When you start your own business, you need many more elements than just an incorporated legal entity to succeed. To begin, you shall have a digital face, a brand name & logo, the same-name legal entity, the same-name domain name, an accountant, a lawyer, a bank account, stamps, website, social media profiles, phone, office, or legal address, business cards, and the templates of documents. BOOST offers plug & play business service when you get the business ready for operations - you have the logo & brand book, documentation templates, legal entity, bank account, accountant, phone, digital face, and legally compliant office. Your business will be ready in 2 weeks. You will get the legal entity with the all necessary attributes to communicate with clients, vendors, employees, the public sector, and ready-for-operation business infrastructure for the startup. As soon as you have plug & play business, you will be able to use the BOOST'shared services and #8 plug & play business tracker

The right start is the best available ready-to-use solution at a fair price. 

 
Berries
Something Special For Startups 

LEAN STARTUP

If you have a startup, do not rush to part with money, open a legal entity, pay for brand book, order business cards, hire an accountant, buy market research, and rent an office. It is quite possible that at the initial stage, you can launch your project without our services. Join our BOOST venture capital community to roll out a lean startup!

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
 

SHARED ECONOMY

Step #2. Optimize.

SCALABLE BUSINESS HEALTH

Start your business at once with a healthy cost structure and headcount by using shared services. Administrative support and back-office functions have to be a commodity service. They can be displaced easily, and you don't need to maintain them in-house. Hence, poorly organized SG&A is a source of value destruction that can cost you up to 20% of annual revenue. Unsatisfactory SG&A function creates cash leakage, sources the majority of fraudulent activities, creates existential risks, and doesn't support core business processes properly. Value-added SG&A function requires much time, specific competencies, knowledge on how to organize, maintain and control SG&A function. SG&A shall align with the business objectives, which is difficult when SG&A functions holding in-house. And a quality control of the SG&A function can double the total SG&A expenses. To have an SG&A organization in-house means the increase of the headcount and fixed costs, which affects your cash flows and decreases profitability. Most of the third-party providers sell you heads & hands "as is" by subscription. That improves your headcount and slightly costs, but that doesn't improve cash flows and profitability. You continue to buy low-performing expertise but make that outside. We offer SG&A shared services "paid when using" basis. We have strict control procedures in place, special manuals, and well-trained personnel sharing our ethics to guarantee a 0-error rate and fraud-free environment. We work for your business 24/7 to make you happy. That helps you to save money, optimize your business model and profitability without additional costs.

Get the economy of scale effect while staying a small enterprise.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

ADVANCED REMEDY

SHARED SERVICES

BOOST renders services to help you to extract the maximum business value for HASHEIGHT business products. Some of the HASHEIGHT products you won't be able to use without BOOST's shared services.

ACCOUNTING

Timely, reliable, complete accounting and reporting are available for every company.

TREASURY

Bank transfers, salary payments, sales, related tax & accounting, control over the budget.

RECEIVABLES & PAYABLES

Reconciliation with vendors, clients, tax and accounting operations, data adjustments.

HR

Salary calculation, accruals, payments, HR records maintenance.

RECONCILIATIONS

We reconcile your accounting data and match them with the supporting documents to ensure the reliability of your reporting.

Sharing of competence allows us to maintain expensive excellent expertise and necessary quality control in place. All that you need to do - buy a part of the shared expertise from the BOOST. Corporations get fixed low prices, high quality of services, and transparency. SMEs get the unique economy of scale advantage.

GLOBAL PROCUREMENT

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
IT & DATA MANAGEMENT

Data processing, storage, management of the IT business infrastructure, business applications, programs, databases.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
 PROCUREMENT

Fraud-free centralized purchases, working capital optimization, logistic, distribution, tax & accounting of procurement operations.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
SALES

Pricing, invoicing, billing, payments processing, tax & accounting of sales, receivables soft & legal collection. 

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
INVENTORY

Handling, marking, shipping, accounting, stocktaking.

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness
LOGISTIC & DISTRIBUTION

Pricing, invoicing, warehouse operations, billing, payments processing, tax & accounting of sales.

We simplify your business and make it more effective. When you use our shared services, you improve your cash flows, profitability, increase enterprise value, ROIC, ROE, and decrease risks and fixed costs.

 
 

STOCKTAKING & RECONCILIATIONS

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

19 years of

EXPERIENCE

A fixed price starts from 0.01 Rub per inventory item.

We have the know-how you need.

RIGHT PRACTICE

Stocktaking and written documented reconciliations are the most important internal control procedures which have to be in place in every company and properly executed. Also, they are vital for the audit of financial reporting. BOOST maintains top-notch expertise in stocktaking and reconciliation procedures compliant with the SOX 404 and RAP requirements. We have the own methodology successfully tested during the SOX compliance audits. 

RIGHT PROCEDURE

  • 24 hours to start;

  • Our procedure delivers strong assurance;

  • Up to 24 hours to complete full physical stocktaking;

  • SOX & RAP compliance;

  • The broad scope of services: inventory, raw materials, WIP, goods in transit, real estate, fixed assets, accounts, intangible assets, receivables, payables;

  • Experienced well-trained Team;

  • Sufficient documented evidence to proceed with the claims if the discrepancies were found.

Maintain your core competence. 

Do not invest in SG&A.

Because we already did that.

97.png
 

UNPLUG GRAVITY

Step #3. Improve.

EXSQUEEZE ME!

Improve the core operations in your business model with the HASHEIGHT products.

Making a profit in white transparent business requires proper competencies. They are rare and expensive to maintain in-house. Cheap incompetence can cost you more. To buy external advisors, you need to pay about $1 mln and spend about three weeks. That is not accessible for SMEs. To hire and keep in-house all people necessary for business development sometimes mean that you need to increase your fixed costs by millions of dollars. And again, SMEs can't take these people on board. Also, there are only 24 hours per day, and all qualified people cannot consult all companies needed that at one time, even large corporations. In any case, the increase in fixed costs makes your budget worse and decreases your sustainability.

We created access to the sound available expertise accessible for everyone. We gathered the people, collected their knowledge, transformed this into algorithms, and put them inside all HASHEIGHT solutions. Now you can buy a cantle of that in a virtual form available for you 24/7 by subscription price and use them in the same schedule. These people are former Fortune-500 executives who achieved outstanding results in the real sector and several well-known successful consulting companies. By subscription price, you can get the automated advisory that is tailored for you and founded on the real performance results of your business.

As soon as you optimized your SG&A and cash flows, get the most benefits by improving your core business with an automated turnaround.

Improve your business from the beginning.  

The BOOST is a global company offering shared service and global procurement compliant with the best available standards. An exclusive distributor of the HASHEIGHT products, global vendor of the Game. www.hasheight.com #boostshared #sharetheboost #buttomup #raevskayarepninaannamariaserafima #hasheight #sharedservices #accounting #stocktaking #globalprocurement #outsourcing #treasury #receivables #payables #soxcompliance #sox404 #usgaap #ukgaap #rap #ifrs #reconciliations #payroll #centralizedfunctions #раевскаярепнинааннамариясерафима #startedinoxford #sbs #oxfordbusinessalumni #theuniversityofoxford #thegame #sharedeconomy #london #moscow #oxford #uk #portsmouth #womenfounders #automatedturnaround #automatedconsulting #crystalball #8plugandplaybusinesstracker #gameartifacts #аннамариясерафимараевскаярепнина #annamariaserafimaraevskayarepnina #boost #boostsharedservices #businessplugandplay #буст #pimpmybusiness

AUTOMATED ADVISORY

If you are a Client of the BOOST Shared Services, you can get the expertise previously only available for the flourishing large-scale companies. You get the automated management consulting by default for a subscription fee through the exclusive usage of the HASHEIGHT products and business artifacts. Our clients can enjoy them without customization.